Vascular effects and electrolyte homeostasis of the natriuretic peptide isolated from Crotalus oreganus abyssus (North American Grand Canyon rattlesnake) venom
Abstract:
Crotalus oreganus abyssus is a rattlesnake that is usually found in the Grand Canyon, United States of America. Knowledge regarding the composition of C. o. abyssus venom is scarce. New natriuretic peptides (NPs) have been isolated and characterized from the venoms of members of the Crotalinae family. The NP family comprises three members, ANP (atrial natriuretic peptide), BNP (b-type natriuretic peptide) and CNP (c-type natriuretic peptide), and has an important role in blood pressure regulation and electrolyte homeostasis. The aim of the present study was to characterize a novel natriuretic-like peptide (Coa-NP2), isolated from C. o. abyssus venom. The Coa-NP2 presents an average molecular mass of 3419.88 Da (theoretical average molecular mass 3418.94 Da, monoisotopic molecular mass 3416.66 Da and theoretical PI 7.78) and its amino acid sequence presents the loop region that is characteristic of natriuretic peptides. The peptide has 32 amino acids and its complete sequence is SYGISSGCFGLKLDRIGTMSGLGCWRLLQDSP. Coa-NP2 is a natriuretic peptide of the ANP/BNP-like family, since the carboxyterminal region of CNP has its own NP domain. We demonstrate, herein, that Coa-NP2 produces a dose-dependent decrease in mean arterial pressure in rats, followed by significant increases in concentrations of markers of nitric oxide formation measured in the plasma and vasorelaxation in a thoracic aortic ring bath. The structural and biological aspects confirm Coa-NP2 as a new natriuretic peptide, isolated from snake venom. © 2012 Elsevier Inc. All rights reserved.
Año de publicación:
2012
Keywords:
- Hypotensive agents
- Nitric oxide
- Snake venoms
- Natriuretc peptides
- Crotalus oreganus abyssus
Fuente:
scopusTipo de documento:
Article
Estado:
Acceso abierto
Áreas de conocimiento:
- Fisiología
- Fisiología
Áreas temáticas de Dewey:
- Farmacología y terapéutica
Objetivos de Desarrollo Sostenible:
- ODS 3: Salud y bienestar
- ODS 15: Vida de ecosistemas terrestres
- ODS 2: Hambre cero